AV40922

Anti-MATR3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Matrin 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 93 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_061322
• nº de adesão UniProt: P43243
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MATR3(9782)

Descrição

Descrição geral

Matrin 3 (MATR3) is a zinc finger inner nuclear matrix protein with two RNA recognition motifs (RRM). MATR3, which is highly regulated, complexes with and stabilizes specific gene transcripts that are currently being identified. Rev appears to be a MATR3 cofactor.

Especificidade

Anti-MATR3 (AB1) polyclonal antibody reacts with chicken, human, mouse, rat, and bovine matrin 3 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human MATR3

Aplicação

Anti-MATR3 (AB1) polyclonal antibody is used to tag matrin 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of matrin 3 as a selective nuclear gene transcript stabilizer.

Ações bioquímicas/fisiológicas

MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Sequência

Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable