AV38287

Anti-NR2C1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Nuclear receptor subfamily 2, group C, member 1, Anti-TR2, Anti-TR2-11
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 67 kDa
• reatividade de espécies: guinea pig, rat, horse, bovine, human, mouse, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_003288
• nº de adesão UniProt: P13056
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NR2C1(7181)

Descrição

Descrição geral

Testicular receptor 2 /nuclear receptor subfamily 2, group C, member 1 (NR2C1, TR2) is a nuclear receptor transcription factor. TR2 is a testicular orphan nuclear receptors that acts to regulate other nuclear receptors. TR2 is believed to regulate early embryonic development by regulating key genes involved in stem cell self-renewal, commitment and differentiation. TR2/TR4 directly represses Gata1/GATA1 transcription in murine and human erythroid progenitor cells.

The previously assigned protein identifier Q15625 has been merged into P13056. Full details can be found on the UniProt database.

Especificidade

Anti-NR2C1 polyclonal antibody reacts with zebrafish, canine, bovine, human, mouse, and rat testicular receptor 2 proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human NR2C1

Aplicação

Anti-NR2C1 polyclonal antibody is used to tag testicular receptor 2 /Nuclear receptor subfamily 2, group C, member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of testicular receptor 2 in early embryonic development and stem cell self-renewal, commitment and differentiation.

Ações bioquímicas/fisiológicas

The nuclear orphan receptors NR2C1 represses transcription and binds DNA as a homodimer. NR2C1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. NR2C1 may function as a negative modulator to suppress androgen receptor function in prostate cancer. NR2C1 may exert an important repressor in regulating ER activity in mammary glands. The nuclear orphan receptors TR2 (NR2C1) and TR4 form a heterodimer that binds to the epsilon and gamma globin promoter DR1 sites

Sequência

Synthetic peptide located within the following region: LPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIGHSI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable