Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV35341

Sigma-Aldrich

Anti-GRIK2 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Glutamate receptor, ionotropic, kainate 2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

98 kDa

reatividade de espécies

bovine, guinea pig, human, rabbit, dog, horse, rat, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_068775

nº de adesão UniProt

Q96KS6

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GRIK2(2898)

Categorias relacionadas

Descrição geral

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).
Rabbit Anti-GRIK2 antibody recognizes canine, human, mouse, rat, bovine, and zebrafish GRIK2.

Imunogênio

Synthetic peptide directed towards the C terminal region of human GRIK2

Aplicação

Rabbit Anti-GRIK2 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.

Ações bioquímicas/fisiológicas

This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Sequência

Synthetic peptide located within the following region: TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 2

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC4629

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Richard Delorme et al.
Neuroreport, 15(4), 699-702 (2004-04-20)
Several lines of evidence suggest that obsessive compulsive disorder (OCD) could be the consequence of glutamatergic dysfunction. We performed a case-control study in 156 patients and 141 controls and the transmission disequilibrium test in 124 parent-offspring trios to search for
G Shaltiel et al.
Molecular psychiatry, 13(9), 858-872 (2008-03-12)
The glutamate receptor 6 (GluR6 or GRIK2, one of the kainate receptors) gene resides in a genetic linkage region (6q21) associated with bipolar disorder (BPD), but its function in affective regulation is unknown. Compared with wild-type (WT) and GluR5 knockout
Mohammad Mahdi Motazacker et al.
American journal of human genetics, 81(4), 792-798 (2007-09-12)
Nonsyndromic mental retardation is one of the most important unresolved problems in genetic health care. Autosomal forms are far more common than X-linked forms, but, in contrast to the latter, they are still largely unexplored. Here, we report a complex

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica