Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV34622

Sigma-Aldrich

Anti-KCNIP4 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Kv channel interacting protein 4

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

29 kDa

reatividade de espécies

mouse, rat, rabbit, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... KCNIP4(80333)

Descrição geral

KCNIP4 is a protein member of the voltage-gated potassium (Kv) channel-interacting family. This protein is known to associate with calcium and presenilin. KCNIP4 has been implicated as a candidate gene for renal cancer, personality and attention-deficit/hyperactivity disorders (PD and ADHD), and asthma.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.

Imunogênio

Synthetic peptide directed towards the N terminal region of human KCNIP4

Aplicação

Rabbit Anti-KCNIP4 antibody is suitable for western blot (1.0 μg/ml) and IHC (4-8 μg/ml) applications.

Ações bioquímicas/fisiológicas

KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin.

Sequência

Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 2

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Lena Weißflog et al.
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology, 23(6), 436-447 (2012-09-18)
Attention-deficit/hyperactivity disorder (ADHD) is a neurodevelopmental disorder in children with striking persistence into adulthood and a high co-morbidity with other psychiatric disorders, including personality disorders (PD). The 4p15.31 region was shown to be associated with ADHD in several genome wide
Anita Bonne et al.
Cancer genetics and cytogenetics, 179(1), 11-18 (2007-11-06)
Our group and others had previously developed a high throughput procedure to map translocation breakpoints using chromosome flow sorting in conjunction with microarray-based comparative genomic hybridization (arrayCGH). Here we applied both conventional positional cloning and integrated arrayCGH procedures to the
Blanca E Himes et al.
PloS one, 8(2), e56179-e56179 (2013-03-05)
Asthma is a common chronic respiratory disease characterized by airway hyperresponsiveness (AHR). The genetics of asthma have been widely studied in mouse and human, and homologous genomic regions have been associated with mouse AHR and human asthma-related phenotypes. Our goal

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica