Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV32841

Sigma-Aldrich

Anti-CHES1 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-Checkpoint suppressor 1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

52 kDa

reatividade de espécies

guinea pig, mouse, human, horse, rat, dog, rabbit

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001078940

nº de adesão UniProt

O00409

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHES1(1112)

Descrição geral

CHES1 (or FOXN3) is a forkhead transcription factor that modulates cell proliferation by supressing PIM2 and protein synthesis. FOXN3 has also been implicated in transcriptional repression, DNA damage responses, hematopoietic cancers, and oral cancers.
Rabbit Anti-CHES1 antibody recognizes chicken, zebrafish, human, mouse, rat, pig, and canine CHES1.

Imunogênio

Synthetic peptide directed towards the C terminal region of human CHES1

Aplicação

Rabbit Anti-CHES1 antibody can be used for western blot applications at a concentration of 1.25μg/ml

Ações bioquímicas/fisiológicas

Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.

Sequência

Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC2322

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Yin-Ju Chen et al.
Head & neck, 33(2), 257-266 (2010-09-18)
This study was undertaken to identify the genes in response to areca nut extract, a potential carcinogen of oral cancer. Two oral cancer sublines chronically treated with areca nut extract were established. Methods such as microarray and immunohistochemistry were used
Kenneth L Scott et al.
Gene, 359, 119-126 (2005-08-17)
Checkpoint Suppressor 1 (CHES1; FOXN3) encodes a member of the forkhead/winged-helix transcription factor family. The human CHES1 cDNA was originally identified by its ability to function as a high-copy suppressor of multiple checkpoint mutants of Saccharomyces cerevisiae. Accumulating expression profile
Valeria Busygina et al.
Cancer research, 66(17), 8397-8403 (2006-09-05)
Multiple endocrine neoplasia type 1 (MEN1) is a cancer susceptibility syndrome affecting several endocrine tissues. Investigations of the biochemical function of the MEN1 protein, menin, have suggested a role as a transcriptional comodulator. The mechanism by which MEN1 inactivation leads

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica