AV32053

Anti-NPAS1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Neuronal PAS domain protein 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 63 kDa
• reatividade de espécies: rabbit, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002508
• nº de adesão UniProt: Q99742
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NPAS1(4861)

Descrição

Descrição geral

NPAS1 is a basic helix-loop-helix transcription factor that that regulates branching morphogenesis in mouse embryonic lung tissues. Studies in mice have reported that NPAS1 deficiency can result in behavioural and functional abnormalities.
Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.

Imunogênio

Synthetic peptide directed towards the C terminal region of human NPAS1

Aplicação

Rabbit Anti-NPAS1 antibody can be used for western blotting at 2μg/ml. It can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

Ações bioquímicas/fisiológicas

NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.

Sequência

Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable