Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV32060

Sigma-Aldrich

Anti-PCSK6 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-Proprotein convertase subtilisin/kexin type 6

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

68 kDa

reatividade de espécies

rabbit, dog, horse, human, mouse, pig, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_612192

nº de adesão UniProt

P29122-5

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PCSK6(5046)

Descrição geral

PCSK6 is a proprotein convertase that processes inactive protein into their active forms. PCSK6 has been linked to handedness in dyslexic individuals and has also been implicated in malignant gliomas.
Rabbit Anti-PCSK6 antibody recognizes human, mouse, rat, and canine PCSK6.

Imunogênio

Synthetic peptide directed towards the N terminal region of human PCSK6

Aplicação

Rabbit Anti-PCSK6 antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Ações bioquímicas/fisiológicas

PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression.

Sequência

Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

12 - Non Combustible Liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC7219

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

S Delic et al.
Neuropathology and applied neurobiology, 38(2), 201-212 (2011-07-05)
The molecular mechanisms underlying the infiltrative growth of glioblastomas, the most common primary tumours of the central nervous system in adults, are still poorly understood. We aimed to identify and functionally validate novel glioma invasion-associated candidate genes. Microarray-based expression analysis
Thomas S Scerri et al.
Human molecular genetics, 20(3), 608-614 (2010-11-06)
Approximately 90% of humans are right-handed. Handedness is a heritable trait, yet the genetic basis is not well understood. Here we report a genome-wide association study for a quantitative measure of relative hand skill in individuals with dyslexia [reading disability
Ying Wang et al.
The Journal of endocrinology, 222(1), 151-160 (2014-05-27)
Mammalian proprotein convertases (PCs) play an important role in folliculogenesis, as they proteolytically activate a variety of substrates such as the transforming growth factor beta (TGFβ) superfamily. PC subtilism/kexin 6 (PCSK6) is a member of the PC family and is

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica