AV31874

Anti-ZBTB32 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Zinc finger and BTB domain containing 32
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 33 kDa
• reatividade de espécies: rat, human, bovine, guinea pig, rabbit
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_055198
• nº de adesão UniProt: Q8WVP2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ZBTB32(27033)

Descrição

Descrição geral

ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ZBTB32

Aplicação

Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Ações bioquímicas/fisiológicas

ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.

Sequência

Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable