Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

AV31375

Sigma-Aldrich

Anti-EN2 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-AUTS1, Anti-AUTS10, Anti-Engrailed homeobox 2

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

34 kDa

reatividade de espécies

dog, mouse, guinea pig, horse, human, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... EN2(2020)

Descrição geral

Engrailed homeodomain-containing transcription factors play crucial roles in brain development across many species, including the determination of the hindbrain/midbrain border, cerebellar patterning and aiding in neuronal axon guidance. Engrailed-2 (En-2) gene is expressed across the mesencephalon/metencephalon (mes/met) boundary in the cerebellar primordium. Engrailed-2 is involved in the determination of skeletal muscle physiologic properties. Urinary EN2 is a highly specific and sensitive candidate biomarker of prostate cancer.
Rabbit polyclonal anti-ENS antibody reacts with chicken, zebrafish, human, mouse, and rat engrailed homeobox 2 transcription factors.

Imunogênio

Synthetic peptide directed towards the C-terminal region of Human EN2

Aplicação

Rabbit Anti-EN2 antibody is suitable for use in western blot (0.5μg/ml) assays.
Rabbit polyclonal anti-ENS antibody is used to tag engrailed homeobox 2 transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of engrailed homeobox 2 transcription factor in brain development and skeletal muscle differentiation.

Ações bioquímicas/fisiológicas

Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Sequência

Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica