AMAB91799

Anti-TFE3 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12822, purified by using Protein A, buffered aqueous glycerol solution

• Sinônimo(s): bHLHe33,TFEA
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• tipo de produto de anticorpo: primary antibodies
• clone: CL12822, monoclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• purificado por: using Protein A
• reatividade de espécies: human
• técnica(s): immunofluorescence: 2-10 μg/mL; immunohistochemistry: 1:1000-1:2500; western blot: 1 μg/mL
• Isotipo: IgG1
• Ensembl | Número de adesão de ser humano: ENSG00000068323
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... TFE3(7030)

Descrição

Imunogênio

Transcription factor binding to ighm enhancer 3

Aplicação

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Características e benefícios

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Sequência

SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Ligação

Corresponding Antigen APREST76155

forma física

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Armazenamento e estabilidade

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1