05-23-2150

PACAP 38, Ovine

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

• Sinônimo(s): PACAP 38, Ovine, Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
• Fórmula empírica (Notação de Hill): C₂₀₃H₃₃₁N₆₃O₅₃S
• Número CAS: 137061-48-4
• Peso molecular: 4534.26
• Número MDL: MFCD00081800
• Código UNSPSC: 12352202
• NACRES: NA.77

Propriedades

• Nível de qualidade: 100
• Ensaio: ≥96% (HPLC)
• Formulário: solid
• fabricante/nome comercial: Calbiochem^®
• condição de armazenamento: OK to freeze; desiccated (hygroscopic)
• cor: white to off-white
• solubilidade: 5% acetic acid: 1 mg/mL
• Condições de expedição: ambient
• temperatura de armazenamento: −20°C

Descrição

Descrição geral

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

Ações bioquímicas/fisiológicas

Cell permeable: no

EC50 = 7 nM against adenylate cyclase

Primary Target
Adenylate cyclase

Product does not compete with ATP.

Reversible: no

Embalagem

Yes

Advertência

Toxicity: Standard Handling (A)

Sequência

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

Reconstituição

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Outras notas

Kobayashi, H., et al. 1994. Brain Res.647, 145.
Chastre, E., et al. 1991. J. Biol. Chem.266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun.166, 81.

Informações legais

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable