SAB2104637

Anti-ATP7A antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-MK, Anti-MNK
• MDL-Nummer: MFCD03455449
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Mol-Gew.: 163 kDa
• Speziesreaktivität: horse, rat, human, mouse, dog, guinea pig, rabbit, bovine
• Verpackung: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_000052
• UniProt-Hinterlegungsnummer: Q04656
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ATP7A(538)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human ATP7A

Biochem./physiol. Wirkung

The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Gol

Sequenz

Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable