SAB1402660

Monoclonal Anti-ACVR1C antibody produced in mouse

clone 2E3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): ACVRLK7, ALK7
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.9 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; proximity ligation assay: suitable
• isotype: IgG2aκ
• NCBI accession no.: BC022530
• UniProt accession no.: Q8NER5
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACVR1C(130399)

Description

General description

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM

Immunogen

ACVR1C (AAH22530.1, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable