WH0001027M1

Monoclonal Anti-CDKN1B antibody produced in mouse

clone 4B4-E6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-CDKN4, Anti-KIP1, Anti-P27KIP1, Anti-cyclin-dependent kinase inhibitor 1B (p27, Kip1)
• MDL number: MFCD00284080
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4B4-E6, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): ELISA: suitable; capture ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC001971
• UniProt accession no.: P46527
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDKN1B(1027)

Descripción

General description

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. (provided by RefSeq)

Immunogen

CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)