Saltar al contenido
MilliporeSigma
Todas las fotos(4)

Key Documents

SAB1401891

Sigma-Aldrich

Monoclonal Anti-HOOK3 antibody produced in mouse

clone 3A5, purified immunoglobulin, buffered aqueous solution

Sinónimos:

FLJ31058, HK3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

NM_032410

UniProt accession no.

Q86VS8

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOOK3(84376)

General description

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM

Immunogen

HOOK3 (NP_115786.1, 622 a.a. ~ 718 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

Biochem/physiol Actions

In Caenorhabditis elegans, the HOOK3 (hook microtubule-tethering protein 3) protein is required for connecting the centrosome and the nucleus. It participates in transport of pericentriolar satellites, needed for centrosomal assembly in neurogenesis. HOOK3-RET (ret proto-oncogene) fusion protein is identified in papillary thyroid carcinoma and it results in tumor formation in nude mice. In presence of Salmonella enterica infection, the Salmonella SpiC (pathogenicity island 2 secreted effector protein) inactivates HOOK3 function and thereby affects the cellular trafficking and phagosome-lysosome fusion.

Physical form

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nathaniel Melling et al.
PloS one, 10(7), e0134614-e0134614 (2015-08-01)
Hook microtubule-tethering protein 3 (HOOK3) is an adaptor protein for microtubule-dependent intracellular vesicle and protein trafficking. In order to assess the role of HOOK3 in prostate cancer we analyzed HOOK3 expression by immunohistochemistry on a TMA containing more than 12,400
Yoram Shotland et al.
Molecular microbiology, 49(6), 1565-1576 (2003-09-03)
The Salmonella SpiC protein is secreted into the cytosol of macrophages via a unique type III secretion system that functions intracellularly to translocate proteins across the phagosomal membrane. The SpiC protein is required for survival within macrophages and inhibition of
Raffaele Ciampi et al.
Endocrine-related cancer, 14(2), 445-452 (2007-07-20)
Chromosomal rearrangements of the RET proto-oncogene (RET/PTC) are the common feature of papillary thyroid carcinoma (PTC). In this study, we report the identification, cloning, and functional characterization of a novel type of RET/PTC rearrangement that results from the fusion of
Xuecai Ge et al.
Neuron, 65(2), 191-203 (2010-02-16)
Centrosome functions are important in multiple brain developmental processes. Proper functioning of the centrosome relies on assembly of protein components into the pericentriolar material. This dynamic assembly is mediated by the trafficking of pericentriolar satellites, which are comprised of centrosomal

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico