HPA006429

Anti-TAF7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-TAF(II)55 antibody produced in rabbit, Anti-TAFII-55 antibody produced in rabbit, Anti-TAFII55 antibody produced in rabbit, Anti-Transcription initiation factor TFIID 55 kDa subunit antibody produced in rabbit, Anti-Transcription initiation factor TFIID subunit 7 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA006429

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: recombinant expression; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• immunogen sequence: ISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKN
• UniProt accession no.: Q15545
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TAF7(6879)

Descripción

General description

TAF7 (TATA-box binding protein associated factor 7) gene is localized to human chromosome 5q31. It is a part of the multi-subunit transcription factor TFIID. It was initially recognized as TBP-associated factor (TAFII) of TFIID, which is specific for RNA polymerase II.

Immunogen

Transcription initiation factor TFIID subunit 7 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

TAF7 (TATA-box binding protein associated factor 7) acts as a transcriptional repressor, where it binds to TAF1, and prevents its acetyl transferase activity. This activity is necessary for the basal transcription of MHC (major histocompatibility class) I. It acts as a regulator of check-point and prevents premature initiation of transcription until the preinitiation complex (PIC) is assembled completely. It interacts with multiple transcription factors such as, Sp1 (specificity protein), YY1 (Yin Yang 1), USF (upstream transcription factor 1), CTF (C-terminal fragment), adenovirus E1A, and HIV-1 (human immunodeficiency virus) Tat (trans-activator of transcription). It is also involved in the activation of thyroid hormone and vitamin D3 receptor in a ligand-independent fashion. It might also be involved in the processing of the 3′ end of mRNA.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70992

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)