SAB5702857

Anti-HSP105/HSPH1 Antibody, clone 9Y7M10, Rabbit Monoclonal

• Synonym(s): HSP105, HSP105A, HSP105B, NY-CO-25
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 9Y7M10, monoclonal
• form: liquid
• mol wt: 105 kDa
• species reactivity: human, rat, rat
• concentration: 0.5 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVG
• UniProt accession no.: Q92598
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HSPH1(10808)

Description

General description

This gene encodes a member of the heat shock protein 70 family of proteins. The encoded protein functions as a nucleotide exchange factor for the molecular chaperone heat shock cognate 71 kDa protein (Hsc70). In addition, this protein plays a distinct but related role as a holdase that inhibits the aggregation of misfolded proteins, including the cystic fibrosis transmembrane conductance regulator (CFTR) protein. Elevated expression of this protein has been observed in numerous human cancers. [provided by RefSeq, Mar 2017]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSP105/HSPH1 (Q92598).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1