SAB2101148
Anti-IL15 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-IL-15, Anti-Interleukin 15, Anti-MGC9721
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
13 kDa
species reactivity
dog, horse, bovine, mouse, pig, human, sheep, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL15(3600)
Related Categories
General description
Interleukin-15 (IL-15), a cytokine, belongs to the 4α-helix bundle cytokine family. IL-15 gene is located on human chromosome 4q31.2.
Immunogen
Synthetic peptide directed towards the N terminal region of human IL15
Biochem/physiol Actions
Interleukin-15 (IL-15) can activate inflammatory cell recruitment, angiogenesis, and synthesis of other inflammatory cytokines. It plays a key role in the progression, homeostatic proliferation, and activation of natural killer (NK) cells, natural killer T (NKT) cells, and intestinal intraepithelial lymphocytes (IELs). IL-15 plays a crucial role in the homeostatic modulation of the cluster of differentiation 8 (CD8) memory T cells. IL-15 upregulates the expression of telomerase and aids in enhancing the proliferative capacity of NK, NKT-like, and CD8 T Cells. Mutation in the IL-15 gene results in psoriasis vulgaris.
Sequence
Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Chromosomal assignment and genomic structure of Il15.
Anderson DM
Genomics, 25(3), 701-706 (1995)
Anjali Mishra et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 20(8), 2044-2050 (2014-04-17)
Interleukin-15 (IL-15) is a proinflammatory cytokine involved in the development, survival, proliferation, and activation of multiple lymphocyte lineages utilizing a variety of signaling pathways. IL-15 utilizes three distinct receptor chains in at least two different combinations to signal and exert
Yan Xia et al.
Journal of immunotherapy (Hagerstown, Md. : 1997), 37(5), 257-266 (2014-05-09)
Tumor-targeted cytokines are a new class of pharmaceutical anticancer agents often considered superior to the corresponding unconjugated cytokines for therapeutic purposes. We generated a new fusion protein, dsNKG2D-IL-15, in which double NKG2D extracellular domains were fused to IL-15, in Escherichia
Patricia K A Mongini et al.
Journal of immunology (Baltimore, Md. : 1950), 195(3), 901-923 (2015-07-03)
Clinical progression of B cell chronic lymphocytic leukemia (B-CLL) reflects the clone's Ag receptor (BCR) and involves stroma-dependent B-CLL growth within lymphoid tissue. Uniformly elevated expression of TLR-9, occasional MYD88 mutations, and BCR specificity for DNA or Ags physically linked
Bieke Broux et al.
Journal of immunology (Baltimore, Md. : 1950), 194(5), 2099-2109 (2015-01-27)
CD4(+)CD28(-) T cells arise through repeated antigenic stimulation and are present in diseased tissues of patients with various autoimmune disorders, including multiple sclerosis (MS). These cells are believed to have cytotoxic properties that contribute to the pathogenic damaging of the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service