SAB2100154

Anti-ARNTL2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Aryl hydrocarbon receptor nuclear translocator-like 2, Anti-BMAL2, Anti-CLIF, Anti-MGC149671, Anti-MGC149672
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 71 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: Q8WYA1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ARNTL2(56938)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human ARNTL2

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

ARNTL2-CLOCK heterodimers activate E-box element (3′-CACGTG-5′) transcription. Also, in umbilical vein endothelial cells, ARNTL2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.

Sequence

Synthetic peptide located within the following region: PTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLST

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable