SAB1413283

Monoclonal Anti-CUX2 antibody produced in mouse

clone 2H8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CUX2
• UNSPSC Code: 51111800

Properties

• conjugate: unconjugated
• Quality Level: 100
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2H8, monoclonal
• form: buffered aqueous solution
• mol wt: 36.74 kDa
• species reactivity: human
• concentration: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• technique(s): ELISA: suitable; western blot: suitable
• isotype: IgG1, kappa
• Protein ID accession no.: NM_015267
• shipped in: dry ice
• storage temp.: -10 to -25°C
• target post-translational modification: unmodified
• Gene Information: human ... CUX2(23316)

Description

General description

Mouse monoclonal antibody raised against a partial recombinant CUX2.

Immunogen

CUX2 (NP_056082.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence

FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE

Physical form

Solution in phosphate buffered saline, pH 7.4

Preparation Note

Purification by Protein A sepharose

Storage and Stability

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable