SAB1402206

Monoclonal Anti-GCHFR antibody produced in mouse

clone 4G6, purified immunoglobulin, buffered aqueous solution

• Synonym(s): GFRP, HsT16933, MGC138467, MGC138469, P35
• UNSPSC Code: 12352203
• NACRES: NA.41
• clone: 4G6, monoclonal
• application: ELISA (c); ELISA (i); IF
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4G6, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.35 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: NM_005258
• UniProt accession no.: P30047
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GCHFR(2644)

Description

General description

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. (provided by RefSeq)

Immunogen

GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable