Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV45710

Sigma-Aldrich

Anti-GPT (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-AAT1, Anti-ALT1, Anti-GPT1, Anti-Glutamic-pyruvate transaminase (alanine aminotransferase)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

bovine, guinea pig, human, dog, mouse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GPT(2875)

Immunogen

Synthetic peptide directed towards the N terminal region of human GPT

Application

Anti-GPT (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Glutamic-pyruvate transaminase (GPT; alanine aminotransferase, AAT1) is a cytosolic enzyme that is important for metabolism of glucose and amino acids. It catalyzes the formation of pyruvate and glutamate by reversible transmination between alanine and 2-oxoglutarate. Activity of this enzyme indicates liver injury due to drug toxicity, alcohol and infection.

Sequence

Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zhang Hong et al.
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology, 23(6), 699-707 (2013-06-26)
Increasing evidence suggests an association between elevated serum aminotransferase levels and metabolic disorders (metabolic syndrome, hyperlipidemia and diabetes mellitus). However, the significance of relatively low levels of aminotransferases in relation to metabolic disorders has not been fully investigated in the
Rong-Ze Yang et al.
Genomics, 79(3), 445-450 (2002-02-28)
Alanine aminotransferase (ALT) catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate, and thereby has a key role in the intermediary metabolism of glucose and amino acids. Two ALT isoenzymes are known to exist, but only
Myriam M Chaumeil et al.
Cancer research, 74(16), 4247-4257 (2014-05-31)
Mutations of the isocitrate dehydrogenase 1 (IDH1) gene are among the most prevalent in low-grade glioma and secondary glioblastoma, represent an early pathogenic event, and are associated with epigenetically driven modulations of metabolism. Of particular interest is the recently uncovered

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service