AV38012

Anti-BACH1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-BTB and CNC homology 1, basic leucine zipper transcription factor 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 82 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001177
• UniProt accession no.: O14867
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BACH1(571)

Description

General description

BTB-basic leucine zipper transcription factor is a member of a novel family of broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) basic region leucine zipper factors.
Bach1 functions as transcription repressor in transfection assays using fibroblast cells and as a transcriptional activator and repressor, respectively, in cultured erythroid cells. Bach1 is involved in the coordination of transcription activation and repression by Maf family members such as MafK. Bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1) inhibits oxidative stress-inducible genes and is a negative regulator of oxidative stress-induced cellular senescence.

Specificity

Anti-BACH1 antibody reacts with human BTB and CNC homology 1, basic leucine zipper transcription factor 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human BACH1

Application

Anti-BACH1 antibody is used to tag BTB and CNC homology 1, basic leucine zipper transcription factor 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of basic leucine zipper transcription factor 1 in the regulation of processes such as cellular response to oxidative stress.

Biochem/physiol Actions

BACH1 is a transcription factor that belongs to the cap′n′collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. Some exons of this gene overlap with some exons from the C21orf41 gene, which is transcribed in an opposite orientation to this gene but does not seem to encode a protein.

Sequence

Synthetic peptide located within the following region: PPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGGISDFCQQMTD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable