Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV34429

Sigma-Aldrich

Anti-USF1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Upstream transcription factor 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

bovine, rat, human, dog, rabbit, horse, mouse, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... USF1(7391)

General description

USF1 is a leucine zipper transcription factor that forms a part of complexes that interact with fatty acid synthase (FAS) insulin response sequence (IRS). Valproic acid (VPA) is known to inhibit adipogenesis by repressing USF1-induced synthesis of fatty acids. Studies have reported that USF1 gene is associated with familial combined hyperlipidemia (FCHL).
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.

Immunogen

Synthetic peptide directed towards the N terminal region of human USF1

Application

Rabbit Anti-USF1 (AB2) can be used for western blot applications at 1.25 μg/ml.

Biochem/physiol Actions

USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).

Sequence

Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

D Wang et al.
The Journal of biological chemistry, 270(48), 28716-28722 (1995-12-01)
Fatty acid synthase (FAS) plays a central role in de novo lipogenesis in mammals. The concentration or activity of FAS in liver and adipose tissue changes dramatically when animals are subjected to nutritional and hormonal manipulations. We previously reported that
Päivi Pajukanta et al.
Nature genetics, 36(4), 371-376 (2004-03-03)
Familial combined hyperlipidemia (FCHL), characterized by elevated levels of serum total cholesterol, triglycerides or both, is observed in about 20% of individuals with premature coronary heart disease. We previously identified a locus linked to FCHL on 1q21-q23 in Finnish families
Miki Yuyama et al.
The Biochemical journal, 459(3), 489-503 (2014-02-12)
VPA (valproic acid), a short-chain fatty acid that is a HDAC (histone deacetylase) inhibitor, is known to suppress adipogenesis. In the present study, we identified the molecular mechanism of VPA-mediated suppression of adipogenesis in adipocytes. VPA suppressed the accumulation of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service