Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

AV09016

Sigma-Aldrich

Anti-HSP90AB1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Heat shock protein 90 kDa α (cytosolic), class B member 1

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

83 kDa

species reactivity

dog, guinea pig, goat, bovine, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_031381

UniProt accession no.

P08238

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HSP90AB1(3326)

Immunogen

Synthetic peptide directed towards the N terminal region of human HSP90AB1

Biochem/physiol Actions

HSP90AB1 (heat shock protein 90kDa α (cytosolic), class B member 1) is a molecular chaperone that mediates protein folding and intracellular trafficking. It interacts with important oncoproteins such as MET, Akt, p53 and Raf-1 kinase and modulates the signaling pathway that results in cell proliferation and survival.

Sequence

Synthetic peptide located within the following region: MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jared J Barrott et al.
The FEBS journal, 280(6), 1381-1396 (2013-01-30)
On the surface heat shock protein 90 (Hsp90) is an unlikely drug target for the treatment of any disease, let alone cancer. Hsp90 is highly conserved and ubiquitously expressed in all cells. There are two major isoforms α and β
Jooeun Bae et al.
Journal of immunology (Baltimore, Md. : 1950), 190(3), 1360-1371 (2013-01-08)
The 90-kDa heat shock protein (Hsp90) has become an important therapeutic target with ongoing evaluation in a number of malignancies. Although Hsp90 inhibitors have a high therapeutic index with limited effects on normal cells, they have been described to inhibit
Hui-Yu Chen et al.
Veterinary parasitology, 205(3-4), 540-550 (2014-10-02)
Anisakid nematodes are distributed worldwide in a wide variety of marine fishes and they are known to cause the zoonotic disease, anisakiasis. The temperature control is commonly applied for prevention and control of anisakiasis. To analyze the cellular response to
Balázs Rada et al.
Inflammation research : official journal of the European Histamine Research Society ... [et al.], 63(10), 821-830 (2014-07-23)
We studied the involvement of calcium and calcium-activated NADPH oxidases in NLRP3 inflammasome activation and IL-1β release to better understand inflammasome signaling in macrophages. Human volunteer blood donors were recruited to isolate monocytes to differentiate them into macrophages. Wild-type or
Xin Zhao et al.
Naunyn-Schmiedeberg's archives of pharmacology, 387(11), 1079-1089 (2014-08-12)
Arsenic trioxide (As2O3) is used to treat acute promyelocytic leukemia. However, the cardiotoxicity of long QT syndrome restricts its clinical application. Previous studies showed that As2O3 can damage the human ether-a-go-go-related gene (hERG) current via disturbing its trafficking to cellular

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service