WH0079053M1

Monoclonal Anti-ALG8 antibody produced in mouse

clone 2E10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-MGC2840, Anti-asparagine-linked glycosylation 8 homolog (yeast, alpha-1,3-glucosyltransferase)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2E10, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu GenBank: NM_024079
• numer dostępu UniProt: Q9BVK2
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: glycosylation
• informacje o genach: human ... ALG8(79053)

Opis

Opis ogólny

This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Immunogen

ALG8 (NP_076984, 260 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)