Przejdź do zawartości
Merck
Wszystkie zdjęcia(5)

Kluczowe dokumenty

WH0057167M3

Sigma-Aldrich

Monoclonal Anti-SALL4 antibody produced in mouse

clone 6E3, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-DRRS, Anti-HSAL4, Anti-MGC133050, Anti-dJ1112F19.1, Anti-sal-like 4 (Drosophila)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

6E3, monoclonal

Formularz

buffered aqueous solution

reaktywność gatunkowa

human, mouse, rat

metody

ELISA: suitable
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

izotyp

IgG1κ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SALL4(57167)

Opis ogólny

Spalt like transcription factor 4 (SALL4) is encoded by the gene with four exons, mapped to human chromosome 20q13.13-q13.2. The encoded protein belongs to the spalt-like protein family. SALL4 is characterized with a multiple zinc finger (ZnF) domains including one N-terminal C2HC-type ZnF and seven C2H2-type ZnF domains. In vertebrates, SALL4 is abundantly expressed in both embryonic and adult stem/stem-like cells.
The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). (provided by RefSeq)

Immunogen

SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS

Zastosowanie

Monoclonal Anti-SALL4 antibody produced in mouse has been used in immunohistochemical staining.

Działania biochem./fizjol.

Spalt like transcription factor 4 (SALL4) plays a crucial role in the regulation of cell stemness in biological development and tumor growth. Thus, this protein can be considered as a potent target for gene therapy. In addition, it also serves as a potential diagnostic marker for testicular germ cell tumors (GCTs). Polymorphisms in the gene are associated with the development of various diseases such as Duane-radial ray syndrome (DRRS, Okihiro syndrome), acro-renal-ocular syndrome (AROS), and SALL4-related Holt-Oram syndrome (HOS).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

12 - Non Combustible Liquids

Klasa zagrożenia wodnego (WGK)

nwg

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Sall4 interacts with Nanog and co-occupies Nanog genomic sites in embryonic stem cells.
Wu Q, et al.
The Journal of Biological Chemistry, 24090-4 null
RNA-binding protein LIN28 is a marker for testicular germ cell tumors
Cao D, et al.
Human Pathology, 710-8 null
SALL4 Is a Novel Diagnostic Marker for Testicular Germ Cell Tumors
Cao D, et al.
American Journal of Surgical Pathology, 1065-77 null
SALL4: engine of cell stemness
Xiong J.
Current gene therapy, 400-11 null
Multigene Deletions on Chromosome 20q13.13-q13.2 Including SALL4 Result in an Expanded Phenotype of Okihiro Syndrome Plus Developmental Delay.
Borozdin W, et al.
Human Mutation, 830 null

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej