Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

WH0055294M2

Sigma-Aldrich

Monoclonal Anti-FBXW7 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-AGO, Anti-CDC4, Anti-DKFZp686F23254, Anti-F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), Anti-FBW7, Anti-FBX30, Anti-FBXW6, Anti-SEL10

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Numer MDL:
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

3D1, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... FBXW7(55294)

Opis ogólny

F-box and WD40 domain protein 7 (FBXW7) is a member of F-box protein family, which acts as a substrate recognition component of the ubiquitin ligase complex SCF (Skp-Cullin-F-box). The proteins have a bipartite structure. The shared F-box motif links F-box protein to Skp1 and the core complex, whereas divergent protein-protein interaction motifs selectively bind their cognate substrates. There are three FBXW7 isoforms α, β ,γ that share 10 out of 11 exons but they differ in their subcellular localization as well as in substrate recognition activity. The gene encoding FBXW7 is localized on human chromosome 4q31.3.

Immunogen

FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Zastosowanie

Monoclonal Anti-FBXW7 antibody produced in mouse has been used in Western blotting and immunohistochemistry.

Działania biochem./fizjol.

F-box proteins are associated with various signaling pathways, such as nutrient sensing in yeast, conserved developmental pathways in plants and animals. These proteins mediate recognition of phosphorylated targets including Cyclin E, Myc, c-Jun, and Notch, leading to their ubiquitination and degradation. Similar to the inactivation mode of other known tumor suppressors, the SV40 large T antigen binds F-box and WD40 domain protein 7 (FBXW7) without detectible effects on its stability, and thus acts as an inhibitor of FBXW7 activity.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

nwg

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

MicroRNA-92a contributes to tumor growth of human hepatocellular carcinoma by targeting FBXW7
Wei Yang
Oncology Reports (2015)
FBXW7 Acts as an Independent Prognostic Marker and Inhibits Tumor Growth in Human Osteosarcoma
Zhanchun Li
International Journal of Molecular Sciences (2015)
The F-box: a new motif for ubiquitin dependent proteolysis in cell cycle regulation and signal transduction.
K L Craig and M Tyers
Progress in Biophysics and Molecular Biology, 72 (1999)
Inactivation of hCDC4 can cause chromosomal instability
Harith Rajagopalan
Nature, 428 (2004)
The SV40 large T antigen contains a decoy phosphodegron that mediates its interactions with Fbw7/hCdc4
Markus Welcker and Bruce E Clurman
The Journal of Biological Chemistry, 280 (2004)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej