WH0009804M1
Monoclonal Anti-TOMM20 antibody produced in mouse
clone 4F3, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-KIAA0016, Anti-MAS20, Anti-MGC117367, Anti-MOM19, Anti-TOM20, Anti-translocase of outer mitochondrial membrane 20 homolog (yeast)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
mouse
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
4F3, monoclonal
Formularz
buffered aqueous solution
reaktywność gatunkowa
human, mouse, rat
metody
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
izotyp
IgG1κ
numer dostępu GenBank
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... TOMM20(9804)
Opis ogólny
Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.
Immunogen
TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Działania biochem./fizjol.
Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Motohisa Tada et al.
Cancer science, 101(5), 1261-1269 (2010-03-25)
We sought to identify genomic changes that could be useful for clinical application, focusing on chromosomal instability and using a high-density single nucleotide polymorphism (SNP) array. We analyzed 34 gastric cancer cell lines for areas of DNA that exhibited copy
Sinem K Saka et al.
Nature communications, 5, 3664-3664 (2014-04-11)
The isotopic composition of different materials can be imaged by secondary ion mass spectrometry. In biology, this method is mainly used to study cellular metabolism and turnover, by pulsing the cells with marker molecules such as amino acids labelled with
Sebastián A Riquelme et al.
European journal of immunology, 45(12), 3269-3288 (2015-10-16)
Heme-oxygenase 1 (HO-1) prevents T cell-mediated inflammatory disease by producing carbon monoxide (CO) and impairing DC immunogenicity. However, the cellular mechanisms causing this inhibition are unknown. Here, we show that CO impairs mitochondrial function in DCs by reducing both the
José R Blesa et al.
Gene, 391(1-2), 198-208 (2007-02-16)
TOMM20 is a subunit of the outer mitochondrial membrane translocase that plays a major role as a receptor of precursor proteins with N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factors 1 and 2 (NRF-1 and NRF-2) play an
E Schleiff et al.
Biochemistry, 37(38), 13052-13058 (1998-09-28)
hTom20 is an outer mitochondrial membrane receptor involved in protein translocation. The cytosolic domain (aa30-145) and selected truncated versions of this domain were overexpressed and purified to study the structure-function relationship of this protein. Our studies reveal that the secondary
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej