WH0005728M1

Monoclonal Anti-PTEN antibody produced in mouse

clone 2G9, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-BZS, Anti-MGC11227, Anti-MHAM, Anti-MMAC1, Anti-PTEN1, Anti-TEP1, Anti-phosphatase and tensin homolog (mutated in multiple advanced cancers 1)
• Numer MDL: MFCD02097285
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2G9, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu GenBank: BC005821
• numer dostępu UniProt: P60484
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PTEN(5728)

Opis

Opis ogólny

Phosphatase and tensin homolog (PTEN) is a tumor-suppressor gene. It encodes for a phosphatase which possesses a tensin-like domain, a catalytic domain and a 220-amino acid carboxy-terminal region. The PTEN gene is localized on human chromosome 10q23.3.

Immunogen

PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL

Zastosowanie

Monoclonal Anti-PTEN antibody produced in mouse has been used in Western Blotting.

Działania biochem./fizjol.

Phosphatase and tensin homolog (PTEN) is a negative regulator of the phosphoinositide 3-kinase (PI3K) pathway. It de-phosphorylates phosphatidylinositol-[3, 4, 5]-tri-phosphate (PIP3). PTEN also has roles in cell growth, proliferation, control of cell cycle and apoptosis. It has been associated with gastric and breast cancers.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)