WH0003081M10

Monoclonal Anti-HGD antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-AKU, Anti-HGO, Anti-homogentisate 1,2-dioxygenase (homogentisate oxidase)
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: ELISA (i); IF
• klon: 3G4, monoclonal
• reaktywność gatunkowa: human
• metody: immunofluorescence: suitable; indirect ELISA: suitable

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3G4, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: suitable; indirect ELISA: suitable
• izotyp: IgG2bκ
• numer dostępu GenBank: NM_000187
• numer dostępu UniProt: Q93099
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HGD(3081)

Opis

Opis ogólny

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. (provided by RefSeq)

Immunogen

HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)