WH0002246M1

Monoclonal Anti-FGF1 antibody produced in mouse

clone 3F5, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-AFGF, Anti-ECGF, Anti-ECGFA, Anti-ECGFB, Anti-ECGFbeta, Anti-FGFA, Anti-FGFalpha, Anti-GLIO703, Anti-HBGF1, Anti-fibroblast growth factor 1 (acidic)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3F5, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC032697
• numer dostępu UniProt: P05230
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FGF1(2246)

Opis

Opis ogólny

FGF1 (fibroblast growth factor 1) gene encodes a member of the fibroblast growth factor (FGF) family. It encodes a pro-angiogenic protein that is ubiquitously expressed. In humans, FGF1 is alternatively spliced into four forms: FGF1A (in kidney), FGF1B (in brain), FGF1-C and -D (in vascular smooth muscle cells and fibroblasts). This gene is located on human chromosome 5q31.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. (provided by RefSeq)

Immunogen

FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Działania biochem./fizjol.

FGF1 (fibroblast growth factor 1) is mainly involved in cell growth, proliferation and neurogenesis. This gene also participates in wound healing, post-ischemic heart repair and making of collaterals after hindlimb ischemia. The protein functions as an angiogenic factor that participates in tissue repair, carcinogenesis, and maintenance of vasculature stability.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)