WH0001969M1

Monoclonal Anti-EPHA2 antibody produced in mouse

clone 6F8, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-ECK, Anti-EPH receptor A2
• Numer MDL: MFCD02096311
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 6F8, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu GenBank: BC037166
• numer dostępu UniProt: P29317
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... EPHA2(1969)

Opis

Opis ogólny

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. (provided by RefSeq)

Immunogen

EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)