SAB5702869

Anti-HLTF Antibody, clone 8T0I2, Rabbit Monoclonal

• Synonim(y): HIP116, HIP116A, HLTF1, RNF80, SMARCA3, SNF2L3, ZBU1
• Kod UNSPSC: 12352203
• NACRES: NA.46
• klon: 8T0I2, monoclonal
• application: WB
• reaktywność gatunkowa: rat, human, rat
• metody: western blot: 1:500 - 1:2000

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 8T0I2, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 114 kDa
• reaktywność gatunkowa: rat, human, rat
• stężenie: 1.04 mg/mL
• metody: western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
• numer dostępu UniProt: Q14527
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HLTF(6596)

Opis

Opis ogólny

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1