SAB5702678

Anti-14-3-3 gamma Antibody, clone 5R4Q4, Rabbit Monoclonal

• Synonim(y): 14-3-3GAMMA, PPP1R170
• Kod UNSPSC: 12352203
• NACRES: NA.46
• klon: 5R4Q4, monoclonal
• application: IHC; WB
• reaktywność gatunkowa: rat, rat, human
• metody: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 5R4Q4, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 28 kDa
• reaktywność gatunkowa: rat, rat, human
• stężenie: 0.25 mg/mL
• metody: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
• numer dostępu UniProt: P61981
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... YWHAG(7532)

Opis

Opis ogólny

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB, IHC

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1