SAB5702463

Anti-TTR Antibody, clone 5H4L7, Rabbit Monoclonal

• Synonim(y): CTS, CTS1, HEL111, HsT2651, PALB, TBPA
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 5H4L7, monoclonal
• Postać: liquid
• reaktywność gatunkowa: mouse, mouse
• stężenie: 0.50 mg/mL
• metody: western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
• numer dostępu UniProt: P02766
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TTR(7276)

Opis

Opis ogólny

This gene encodes transthyretin, one of the three prealbumins including alpha-1-antitrypsin, transthyretin and orosomucoid. Transthyretin is a carrier protein; it transports thyroid hormones in the plasma and cerebrospinal fluid, and also transports retinol (vitamin A) in the plasma. The protein consists of a tetramer of identical subunits. More than 80 different mutations in this gene have been reported; most mutations are related to amyloid deposition, affecting predominantly peripheral nerve and/or the heart, and a small portion of the gene mutations is non-amyloidogenic. The diseases caused by mutations include amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis, carpal tunnel syndrome, etc. [provided by RefSeq, Jan 2009]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1