SAB5702439

Anti-PFKFB3 Antibody, clone 7X10D9, Rabbit Monoclonal

• Synonim(y): IPFK2, PFK2, iPFK-2
• Kod UNSPSC: 12352203
• NACRES: NA.46
• klon: 7X10D9, monoclonal
• application: IHC; IP; WB
• reaktywność gatunkowa: mouse, mouse
• metody: immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 7X10D9, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 60 kDa
• reaktywność gatunkowa: mouse, mouse
• stężenie: 1 mg/mL
• metody: immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT
• numer dostępu UniProt: Q16875
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PFKFB3(5209)

Opis

Opis ogólny

The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2016]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB, IHC, IP

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Piktogramy: GHS07,GHS09
• Hasło ostrzegawcze: Warning
• Zwroty wskazujące rodzaj zagrożenia: H317,H411
• Zwroty wskazujące środki ostrożności: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Klasyfikacja zagrożeń: Aquatic Chronic 2 - Skin Sens. 1
• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3