SAB5702254

Anti-Somatostatin (SST) Antibody, clone 7Q4T0, Rabbit Monoclonal

• Synonim(y): SST,SMST
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 7Q4T0, monoclonal
• Formularz: liquid
• reaktywność gatunkowa: mouse, rat
• stężenie: 1 mg/mL
• metody: immunohistochemistry: 1:50 - 1:200
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• numer dostępu UniProt: P61278
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SST(6750)

Opis

Opis ogólny

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).

Zastosowanie

IHC

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Piktogramy: GHS07,GHS09
• Hasło ostrzegawcze: Warning
• Zwroty wskazujące rodzaj zagrożenia: H317,H411
• Zwroty wskazujące środki ostrożności: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Klasyfikacja zagrożeń: Aquatic Chronic 2 - Skin Sens. 1
• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3