SAB5702178

Anti-Thyroid Peroxidase Antibody, clone 3C4A4, Rabbit Monoclonal

• Synonim(y): MSA, TDH2A, TPX
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 3C4A4, monoclonal
• Postać: liquid
• reaktywność gatunkowa: rat, human, rat
• stężenie: 1.09 mg/mL
• metody: immunohistochemistry: 1:50 - 1:200
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQA
• numer dostępu UniProt: P07202
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TPO(7173)

Opis

Opis ogólny

This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, May 2011]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

IHC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1