SAB2108783

Anti-SIM1 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.45

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: biotin conjugate
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 85 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): mouse, guinea pig, canine, rabbit, bovine, pig, horse, human
• stężenie: 0.5 mg/mL
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• numer dostępu NCBI: NM_005068
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SIM1(6492)

Opis

Opis ogólny

SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.

Immunogen

Synthetic peptide directed towards the middle region of Human SIM1

Sekwencja

Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable