SAB2108752

Anti-WT1

affinity isolated antibody

• Synonim(y): Anti- AWT1, Anti- WAGR, Anti- WIT-2, Anti- WT33, Anti-GUD
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 56 kDa
• reaktywność gatunkowa: human, rabbit, dog, rat, mouse
• stężenie: 0.5-1 mg/mL
• metody: immunoblotting: suitable; immunohistochemistry: suitable
• nr dostępu: NM_024424
• numer dostępu UniProt: P19544
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... WT1(7490)

Opis

Opis ogólny

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Immunogen

Synthetic peptide directed towards the middle region of human WT1

Działania biochem./fizjol.

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Sekwencja

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable