Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

SAB2106448

Sigma-Aldrich

Anti-SIX1 antibody produced in rabbit

affinity isolated antibody

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.43

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

32 kDa

reaktywność gatunkowa

human, guinea pig, rat, dog, horse, mouse, bovine, sheep, rabbit

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NM_009189

numer dostępu UniProt

Q62231

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SIX1(6495)
mouse ... Six1(20471)

Opis ogólny

Sine oculis homeobox homolog 1 (SIX1) is a transcription factor, having a homeodomain. It is part of the homeoprotein family and is expressed during embryogenesis. The gene encoding this protein is localized on human chromosome 14q23.1.

Immunogen

The immunogen for anti-SIX1 antibody: synthetic peptide derected towards the N terminal of human SIX1

Działania biochem./fizjol.

Sine oculis homeobox homolog 1 (SIX1) enhances the rate of proliferation of cells and their survival. It has a role in organogenesis and has been linked to several malignancies.

Sekwencja

Synthetic peptide located within the following region: ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

The role of Six1 signaling in paclitaxel-dependent apoptosis in MCF-7 cell line
Armat MA, et al.
Bosnian Journal of Basic Medical Sciences / Udruzenje Basicnih Mediciniskih Znanosti = Association of Basic Medical Sciences, 16(1), 28-28 (2016)
Inhibition of Six1 affects tumour invasion and the expression of cancer stem cell markers in pancreatic cancer
Tristan L, et al.
BMC Cancer, 17(1), 249-249 (2017)
Baowei Li et al.
Medical science monitor : international medical journal of experimental and clinical research, 24, 2271-2279 (2018-04-16)
BACKGROUND The objective of this study was to explore the role of SIX1 in paclitaxel (TAX) resistance of HepG2 cells via reactive oxygen species (ROS) and autophagy pathway. MATERIAL AND METHODS Hepatoma cell line HepG2 was treated with SIX1 knockdown
Aberrant expression of homeobox gene SIX1 in Hodgkin lymphoma.
Nagel S, et al.
Oncotarget, 6(37), 40112-40112 (2015)
Huixin Lv et al.
Experimental and molecular pathology, 97(1), 74-80 (2014-05-29)
Sine oculis homeobox homolog 1 (SIX1) protein is a member of the homeobox transcription factor family. Overexpression of SIX1 contributes to cancer progression and is associated with adverse outcomes in various cancer types including breast, ovarian, uterine cervical and liver.
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej