SAB2105544

Anti-SLC2A8 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-GLUT8, Anti-GLUTX1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 51 kDa
• reaktywność gatunkowa: rabbit, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NM_014580
• numer dostępu UniProt: Q9NY64
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC2A8(29988)

Opis

Opis ogólny

Solute carrier family 2 member 8 (SLC2A8)/Glucose transporter 8 (GLUT8), a class III sugar transporter, is expressed in the testis and brain. In the brain, GLUT8 is expressed mainly in the cerebral cortex, hippocampus, amygdala, and hypothalamus.

Immunogen

Synthetic peptide directed towards the middle region of human SLC2A8

Działania biochem./fizjol.

Solute carrier family 2 member 8 (SLC2A8)/glucose transporter 8 (GLUT8) plays a key role in modulating the transport of fructose and the utilization of mammalian fructose. It is a trehalose transporter found in mammals that is necessary for trehalose-induced autophagy. SLC2A8 can also transport intracellular hexose. Hence, it might serve as a multifunctional sugar transporter.

Sekwencja

Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable