Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

SAB2104121

Sigma-Aldrich

Anti-CHAC2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

21 kDa

reaktywność gatunkowa

guinea pig, human, mouse, dog, rat, rabbit, bovine

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NM_001008708

numer dostępu UniProt

Q8WUX2

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CHAC2(494143)

Opis ogólny

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases. It carries a methionine (Met) residue at the N-terminus.

Immunogen

Synthetic peptide directed towards the N terminal region of human CHAC2

Zastosowanie

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.

Działania biochem./fizjol.

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals. In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Sekwencja

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Shuiping Liu et al.
Cell death & disease, 8(8), e3009-e3009 (2017-08-25)
Tumor suppressor genes play a key role in cancer pathogenesis. Through massive expression profiling we identified CHAC2 as a frequently downregulated gene in gastric and colorectal cancers. Immunohistochemistry and western blot revealed that CHAC2 was downregulated in most tumor tissues
Yen T K Nguyen et al.
Biomolecules, 10(1) (2019-12-28)
Glutathione (GSH) degradation plays an essential role in GSH homeostasis, which regulates cell survival, especially in cancer cells. Among human GSH degradation enzymes, the ChaC2 enzyme acts on GSH to form 5-l-oxoproline and Cys-Gly specifically in the cytosol. Here, we
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej