SAB2102370

Anti-TAP1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ABC17, Anti-ABCB2, Anti-APT1, Anti-D6S114E, Anti-Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• Numer MDL: MFCD00283209
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 87 kDa
• reaktywność gatunkowa: human, rat, mouse
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu UniProt: Q03518
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TAP1(6890)

Opis

Opis ogólny

The transporter protein associated with antigen processing-1 (TAP1) belongs to the major histocompatibility complex (MHC) class I peptide-loading complex. TAP1 is also termed as the partner of sld five 1 (PSF1). PSF1 belongs to the heterotetrameric complex, known as GINS. It is located on human chromosome 6p21.

Immunogen

Synthetic peptide directed towards the middle region of human TAP1

Zastosowanie

Anti-TAP1 antibody has been used in immunoprecipitation.

Działania biochem./fizjol.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
Knockdown of PSF1 expression blocks the multiplication of cell in lung cancer cells in vitro.

Sekwencja

Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable