SAB2100658

Anti-EIF2AK1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Eukaryotic translation initiation factor 2-α kinase 1, Anti-HRI, Anti-KIAA1369
• Numer MDL: MFCD03455796
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: IHC; WB
• klon: polyclonal
• reaktywność gatunkowa: dog, guinea pig, horse, human, mouse, rabbit, rat, bovine
• metody: immunohistochemistry: suitable; western blot: suitable

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 71 kDa
• reaktywność gatunkowa: dog, guinea pig, horse, human, mouse, rabbit, rat, bovine
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu UniProt: Q9BQI3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... EIF2AK1(27102)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human EIF2AK1

Działania biochem./fizjol.

EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3′ end slightly overlaps the 3′ end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.

Sekwencja

Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable