SAB2100076

Anti-AHCYL1 (ab1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-DCAL, Anti-IRBIT, Anti-PRO0233, Anti-S-Adenosylhomocysteine hydrolase-like 1, Anti-XPVKONA
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 59 kDa
• reaktywność gatunkowa: rat, bovine, guinea pig, horse, dog, human, mouse, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu UniProt: O43865
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... AHCYL1(10768)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human AHCYL1

Działania biochem./fizjol.

AHCYL1 belongs to the adenosylhomocysteinase family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 enables NBC1 variants to have different physiological roles.

Sekwencja

Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable