SAB1412548

ANTI-TLR4 antibody produced in mouse

clone 4B10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): ARMD10, CD284, TLR4, TOLL, hToll
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 4B10, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen 34.32 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu NCBI: NM_138554
• numer dostępu UniProt: O00206
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TLR4(7099)

Opis

Opis ogólny

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. (provided by RefSeq)

Toll like receptor 4 (TLR4) is an extracellular pathogen recognition receptor (PRR), encoded by the gene mapped to human chromosome 9q32–33. The encoded protein belongs to the interleukin-1 (IL-1)/toll receptor family and is present on both immune and nonimmune cells.

Immunogen

TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA

Działania biochem./fizjol.

Toll like receptor 4 (TLR4) is a bacterial lipopolysaccharide (LPS) sensor. It plays a vital role in regulation of innate immunity. Palmitic acid (PA) interacts with TLR4 to stimulate pro-inflammatory cytokine interleukin-1β (IL-1β) secretion in human immune cells. Elevated expression of TLR4 is associated with the lupus nephritis (LN) and chronic cutaneous lupus erythematosus (CLE) pathogenesis. Genetic variations in the gene has been observed in patients with esophageal adenocarcinoma (EAC).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable