Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Kluczowe dokumenty

SAB1405825

Sigma-Aldrich

Anti-Fibronectin Antibody

mouse polyclonal

Synonim(y):

CIG, DKFZp686F10164, DKFZp686H0342, DKFZp686I1370, DKFZp686O13149, ED-B, FINC, FN, FNZ

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(4)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

product name

Anti-FN1 antibody produced in mouse, purified immunoglobulin, buffered aqueous solution

pochodzenie biologiczne

mouse

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

antigen ~17.93 kDa

reaktywność gatunkowa

human

metody

indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1 μg/mL

numer dostępu NCBI

BC005858

numer dostępu UniProt

P02751

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... FN1(2335)

Opis ogólny

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. (provided by RefSeq)

Immunogen

FN1 (AAH05858, 1 a.a. ~ 163 a.a) full-length human protein.

Sequence
MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

T E Klug et al.
European journal of clinical microbiology & infectious diseases : official publication of the European Society of Clinical Microbiology, 33(10), 1733-1739 (2014-05-09)
A polymicrobial mixture of aerobic and anaerobic bacteria is commonly recovered from peritonsillar abscess (PTA) aspirates. Previous studies have suggested a role for Fusobacterium necrophorum (FN) in the development of PTA. The purpose of the current study was to explore
Laetitia Sabatier et al.
FEBS letters, 588(17), 2890-2897 (2014-07-19)
Fibrillins form multifunctional microfibrils in most connective tissues. Deficiencies in fibrillin assembly can result in fibrillinopathies, such as Marfan syndrome. We demonstrate the presence of heparin/heparan sulfate binding sites in fibrillin-2 and -3. Multimerization of all three fibrillins drastically increased
JanWillem Duitman et al.
Molecular medicine (Cambridge, Mass.), 20, 410-416 (2014-05-21)
Accumulating evidence shows that protease-activated receptor-1 (PAR-1) plays an important role in the development of fibrosis, including lung fibrosis. However, whether PAR-1 also plays a role in the development of skin fibrosis remains elusive. The aim of this study was
Min Wang et al.
International journal of oncology, 45(1), 362-372 (2014-05-09)
Evidence in literature has demonstrated that some microRNAs (miRNAs) play a pivotal role in most solid tumor metastasis. Previous studies have showed that miR-100 is downregulated in human prostate cancer tissue compared to normal prostate and also significantly decreased in
Déborah François et al.
Laboratory investigation; a journal of technical methods and pathology, 94(11), 1237-1246 (2014-09-10)
Idiopathic pulmonary fibrosis (IPF) is a chronic diffuse lung disease characterized by an accumulation of excess fibrous material in the lung. Protease nexin-1 (PN-1) is a tissue serpin produced by many cell types, including lung fibroblasts. PN-1 is capable of
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej