SAB1404899

Monoclonal Anti-ADAM29 antibody produced in mouse

clone 1F6, ascites fluid

• Synonim(y): svph1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: ascites fluid
• rodzaj przeciwciała: primary antibodies
• klon: 1F6, monoclonal
• masa cząsteczkowa: antigen ~32.71 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable
• izotyp: IgMκ
• numer dostępu NCBI: NM_014269
• numer dostępu UniProt: Q9UKF5
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ADAM29(11086)

Opis

Opis ogólny

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. (provided by RefSeq)

Immunogen

ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK

Postać fizyczna

Clear solution

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable